CoraLite® Plus 488-conjugated ST6GALNAC6 Monoclonal antibody

• 

  IF Staining of human colon cancer using CL488-66209

  Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CoraLite® Plus 488 ST6GALNAC6 antibody (CL488-66209, Clone: 1A7B7 ) at dilution of 1:200.

• 

  IF Staining of U2OS using CL488-66209

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CoraLite® Plus 488 ST6GALNAC6 antibody (CL488-66209, Clone: 1A7B7 ) at dilution of 1:200.

ST6GALNAC6 Monoclonal Antibody for IF/ICC, IF-P

Cat No. CL488-66209

Clone No.1A7B7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC, IF-P

Synonyms

Sialyltransferase 7F, RP11 203J24.3, hST6GalNAc VI, GalNAc alpha-2,6-sialyltransferase VI, EC:2.4.99.-

---

Tested Applications

• Positive IF-P detected in: human colon cancer tissue
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66209 targets ST6GALNAC6 in IF/ICC, IF-P applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8358

  Product name: Recombinant human ST6GALNAC6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 67-333 aa of BC007802

  Sequence: VFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT

• Full Name: ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
• Calculated Molecular Weight: 333aa,38 kDa; 374aa,41 kDa
• Observed Molecular Weight: 38-42 kDa
• GenBank Accession Number: BC007802
• Gene Symbol: ST6GALNAC6
• Gene ID (NCBI): 30815
• RRID: AB_2919299
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q969X2
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ST6GALNAC6 is a sialyltransferase that is responsible for the synthesis of all a-series gangliosides. It has a broad expression pattern. ST6GALNAC6 was reported to be a key enzyme in the synthesis of disialyl monosialyl Lewis (Lea), a representative tumor-associated antigen in cancers of the pancreas and colon.