STAG2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• STAG2 Polyclonal antibody (19837-1-AP)

STAG2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 19837-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Cohesin subunit SA 2, Cohesin subunit SA-2, SA 2, SA2, Stromal antigen 2

• 

  WB analysis of Jurkat using 19837-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 19837-1-AP (STAG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 19837-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 19837-1-AP (STAG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 19837-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 19837-1-AP (STAG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 19837-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 19837-1-AP (STAG2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 19837-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 19837-1-AP (STAG2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of MCF-7 using 19837-1-AP

  IP result of anti-STAG2 (IP:19837-1-AP, 4ug; Detection:19837-1-AP 1:3000) with MCF-7 cells lysate 2120 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of U-251 using 19837-1-AP

  IP result of anti-STAG2 (IP:19837-1-AP, 4ug; Detection:19837-1-AP 1:3000) with U-251 cells lysate 3320 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 19837-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 19837-1-AP (STAG2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 19837-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer using 19837-1-AP (STAG2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 19837-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 19837-1-AP (STAG2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 19837-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 19837-1-AP (STAG2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 19837-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 19837-1-AP (STAG2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat colon using 19837-1-AP

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 19837-1-AP (STAG2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat lung using 19837-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 19837-1-AP (STAG2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 19837-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 19837-1-AP (STAG2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 19837-1-AP

  Immunofluorescent analysis of 293 cells, using STAG2 antibody 19837-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 19837-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using STAG2 antibody (19837-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, K-562 cells, MCF-7 cells, NIH/3T3 cells
• Positive IP detected in: U-251 cells, MCF-7 cells
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19837-1-AP targets STAG2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13825

  Product name: Recombinant human STAG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1047-1172 aa of BC001765

  Sequence: SLLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVE

• Full Name: stromal antigen 2
• Calculated Molecular Weight: 1231 aa, 141 kDa
• Observed Molecular Weight: 130-141 kDa
• GenBank Accession Number: BC001765
• Gene Symbol: STAG2
• Gene ID (NCBI): 10735
• RRID: AB_10666847
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N3U4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STAG2, also named as SA2, is a component of cohesin complex, a complex required for the cohesion of sister chromatids after DNA replication. The cohesin complex may play a role in spindle pole assembly during mitosis. Mutations in STAG2 appear to be a first step in the transformation of a normal cell into a cancer cell.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Commun (Lond); Squalene epoxidase promotes colorectal cancer cell proliferation through accumulating calcitriol and activating CYP24A1-mediated MAPK signaling.; Authors - Luwei He
human	WB	bioRxiv; Robust CENP-A incorporation in human cells is independent of transcription and cohesin components.; Authors - Reito Watanabe
human	IHC	Nat Commun; Time-resolved multiomics profiling reveals chromatin O-GlcNAc modification promotes senescence-associated transcriptional program.; Authors - Nana Zhang
human	IF	PLoS One; STAG2 mutations in the normal colon induce upregulation of oncogenic pathways in neighbouring wildtype cells.; Authors - Wei Ni Yew ; KO Validated