STAMBP Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86601-3-RR (same clone as 86601-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86601-3-RR (STAMBP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86601-3-PBS in a different storage buffer formulation.

• 

  WB analysis using 86601-3-RR (same clone as 86601-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86601-3-RR (STAMBP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86601-3-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 86601-3-RR (same clone as 86601-3-PBS)

  Rat brain tissue was subjected to SDS PAGE followed by western blot with 86601-3-RR (STAMBP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86601-3-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 86601-3-RR (same clone as 86601-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using STAMBP antibody (86601-3-RR, Clone: 251545B3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86601-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86601-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86601-3-RR against Human STAMBP were performed. The affinity constant is 15.2 pM.

STAMBP Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86601-3-PBS

Clone No.251545B3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

AMSH, EC:3.4.19.-, Endosome-associated ubiquitin isopeptidase, STAM binding protein, STAM-binding protein

---

Product Information

86601-3-PBS targets STAMBP in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1895

  Product name: Recombinant human STAMBP protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 124-424 aa of BC007682

  Sequence: EKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR

• Full Name: STAM binding protein
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC007682
• Gene Symbol: STAMBP
• Gene ID (NCBI): 10617
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95630
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STAM-binding protein (STAMBP) is also named AMSH. STAMBP, a member of the Jab1/MPN metalloenzyme family of deubiquitinating enzymes (DUBs), specifically cleaves K63-linked polyubiquitination chains from substrates (PMID: 15314065, PMID: 26601948). STAMBP is implicated in the endosome-lysosome pathway and shuttles ubiquitinated substrate proteins to lysosomes for degradation (PMID: 10383417, PMID: 24151880). STAMBP regulates protein degradation by binding to the ESCRT-0 protein STAM and the charged multivesicular body proteins of the ESCRT-III complex (PMID: 20159979). STAMBP is implicated in the inflammatory response by promoting the deubiquitination and stabilization of NALP7 and increasing the activity of inflammasomes (PMID: 28492230). STAMBP expression was increased in the cytoplasm of tumor cells from LUAD patients. STAMBP overexpression promoted cell migration and invasion, whereas STAMBP knockdown attenuated these processes in LUAD cells after epidermal growth factor treatment (PMID: 3410245).