• All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
×
×
Host
0
Species Reactivity
0
Species Reactivity
0
Conjugate
0
Conjugate
0
Compatible Species
0
Conjugate
0
Use Able AI chat for product recommendations
Filter:
  • Western Blot (WB) analysis of various lysates using STAMBP Recombinant monoclonal antibody (86601-3-RR)

    WB analysis using 86601-3-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 86601-3-RR (STAMBP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of various lysates using STAMBP Recombinant monoclonal antibody (86601-3-RR)

    WB analysis using 86601-3-RR

    Various lysates were subjected to SDS PAGE followed by western blot with 86601-3-RR (STAMBP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of rat brain tissue using STAMBP Recombinant monoclonal antibody (86601-3-RR)

    WB analysis of rat brain using 86601-3-RR

    Rat brain tissue was subjected to SDS PAGE followed by western blot with 86601-3-RR (STAMBP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  • Immunofluorescence (IF) / fluorescent staining of K-562 cells using STAMBP Recombinant monoclonal antibody (86601-3-RR)

    IF Staining of K-562 using 86601-3-RR

    Immunofluorescent analysis of (4% PFA) fixed K-562 cells using STAMBP antibody (86601-3-RR, Clone: 251545B3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  • Affinity and Kinetic Characterization of 86601-3-RR

    Affinity and Kinetic Characterization of 86601-3-RR

    Biolayer interferometry (BLl) kinetic assays of 86601-3-RR against Human STAMBP were performed. The affinity constant is 15.2 pM.

STAMBP Recombinant monoclonal antibody

STAMBP Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 86601-3-RR
Clone No.251545B3

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

AMSH, EC:3.4.19.-, Endosome-associated ubiquitin isopeptidase, STAM binding protein, STAM-binding protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Tested Applications

Positive WB detected inA549 cells, NIH/3T3 cells, rat brain tissue, Jurkat cells, SW480 cells, K-562 cells, mouse brain tissue
Positive IF/ICC detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86601-3-RR targets STAMBP in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1895

Product name: Recombinant human STAMBP protein

Source: e coli.-derived, PKG

Tag: GST

Domain: 124-424 aa of BC007682

Sequence: EKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR

Predict reactive species
Full Name STAM binding protein
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC007682
Gene Symbol STAMBP
Gene ID (NCBI) 10617
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95630
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STAM-binding protein (STAMBP) is also named AMSH. STAMBP, a member of the Jab1/MPN metalloenzyme family of deubiquitinating enzymes (DUBs), specifically cleaves K63-linked polyubiquitination chains from substrates (PMID: 15314065, PMID: 26601948). STAMBP is implicated in the endosome-lysosome pathway and shuttles ubiquitinated substrate proteins to lysosomes for degradation (PMID: 10383417, PMID: 24151880). STAMBP regulates protein degradation by binding to the ESCRT-0 protein STAM and the charged multivesicular body proteins of the ESCRT-III complex (PMID: 20159979). STAMBP is implicated in the inflammatory response by promoting the deubiquitination and stabilization of NALP7 and increasing the activity of inflammasomes (PMID: 28492230). STAMBP expression was increased in the cytoplasm of tumor cells from LUAD patients. STAMBP overexpression promoted cell migration and invasion, whereas STAMBP knockdown attenuated these processes in LUAD cells after epidermal growth factor treatment (PMID: 3410245).

Protocols

Product Specific Protocols
IF protocol for STAMBP antibody 86601-3-RRDownload protocol
WB protocol for STAMBP antibody 86601-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
||
New chat Able
正在加载，请稍候...