STAMBPL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• STAMBPL1 Polyclonal antibody (27315-1-AP)

STAMBPL1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27315-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

ALMalpha, AMSH FP, AMSH like protease, AMSH LP, AMSHLP, KIAA1373, STAM binding protein like 1, STAMBPL1

• 

  WB analysis using 27315-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27315-1-AP (STAMBPL1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 27315-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 27315-1-AP (STAMBPL1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 27315-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 27315-1-AP (STAMBPL1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 27315-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27315-1-AP (STAMBPL1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 27315-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 27315-1-AP (STAMBPL1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 27315-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27315-1-AP (STAMBPL1 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 27315-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27315-1-AP (STAMBPL1 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27315-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27315-1-AP (STAMBPL1 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 27315-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27315-1-AP (STAMBPL1 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for STAMBPL1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, MCF-7 cells, human testis tissue, Jurkat cells
• Positive IHC detected in: human liver tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27315-1-AP targets STAMBPL1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26308

  Product name: Recombinant human STAMBPL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 116-289 aa of BC010846

  Sequence: PRTDELKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFLQLAESNTVR

• Full Name: STAM binding protein-like 1
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC010846
• Gene Symbol: STAMBPL1
• Gene ID (NCBI): 57559
• RRID: AB_2880840
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96FJ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-STAMBPL1 antibody (Cat# 27315-1-AP) has 4 total citations published in Phytomedicine, Cell Reports, Translational Oncology, and Molecular Carcinogenesis. These studies span research fields including hepatocellular carcinoma, lung adenocarcinoma, amino acid metabolism regulation, EGFR protein stability, and Wnt/β-catenin signaling pathway. Applications used include Western blot, immunofluorescence, co-immunoprecipitation, and immunohistochemistry in human and mouse samples.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Phytomedicine; A multi-omic analysis reveals that Gamabufotalin exerts anti-hepatocellular carcinoma effects by regulating amino acid metabolism through targeting STAMBPL1; Authors - Piao Zheng
human,mouse	WB,IF,CoIP	Cell Rep; A MYC-STAMBPL1-TOE1 positive feedback loop mediates EGFR stability in hepatocellular carcinoma; Authors - Hongli Zhang ; KO Validated
human	WB	Transl Oncol; STAMBPL1 promotes the progression of lung adenocarcinoma by inhibiting DHRS2 expression; Authors - Xiang Yang
human	WB,IHC	Mol Carcinog; STAMBPL1, transcriptionally regulated by SREBP1, promotes malignant behaviors of hepatocellular carcinoma cells via Wnt/β-catenin signaling pathway; Authors - Junyi Jin