STARD10 Polyclonal antibody

• 

  WB analysis using 17048-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17048-1-AP (STARD10 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 17048-1-AP

  IP result of anti-STARD10 (IP:17048-1-AP, 4ug; Detection:17048-1-AP 1:300) with HepG2 cells lysate 3400 ug.

• 

  IHC staining of human liver using 17048-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 17048-1-AP (STARD10 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver using 17048-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 17048-1-AP (STARD10 antibody) at dilution of 1:100 (under 40x lens).

STARD10 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 17048-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, IHC, ELISA

Synonyms

Antigen NY CO 28, CGI 52, NY CO 28, PCTP L, PCTP like protein, PCTP2, SDCCAG28, STARD10

---

Tested Applications

• Positive WB detected in: MCF-7 cells, T-47D cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17048-1-AP targets STARD10 in WB, IP, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10705

  Product name: Recombinant human STARD10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-291 aa of BC007919

  Sequence: MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT

• Full Name: StAR-related lipid transfer (START) domain containing 10
• Calculated Molecular Weight: 291 aa, 33 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC007919
• Gene Symbol: STARD10
• Gene ID (NCBI): 10809
• RRID: AB_2255485
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y365
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STARD10 (START domain-containing protein 10, also known as PCTP-like protein) is highly expressed in liver and responsible to transfer phosphatidylcholine. STARD10 was identified as a protein overexpressed in breast cancer that cooperates with the ErbB family of receptor tyrosine kinases in cellular transformation (PMID: 15911624). This antibody detected duplicate bands between 35-40 kDa (PMID: 15150109).