Tested Applications
| Positive WB detected in | U2OS cells, HEK-293 cells, mouse kidney tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human breast cancer tissue, rat thyroid gland tissue, mouse epididymis tissue, human thyroid cancer tissue, mouse stomach tissue, rat stomach tissue, rat epididymis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20502-1-AP targets STARD3NL in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14273 Product name: Recombinant human STARD3NL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 162-234 aa of BC005959 Sequence: ILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL Predict reactive species |
| Full Name | STARD3 N-terminal like |
| Calculated Molecular Weight | 234 aa, 27 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC005959 |
| Gene Symbol | STARD3NL |
| Gene ID (NCBI) | 83930 |
| RRID | AB_10694281 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95772 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for STARD3NL antibody 20502-1-AP | Download protocol |
| IHC protocol for STARD3NL antibody 20502-1-AP | Download protocol |
| IP protocol for STARD3NL antibody 20502-1-AP | Download protocol |
| WB protocol for STARD3NL antibody 20502-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The STARD3NL Polyclonal antibody (Cat# 20502-1-AP) has 3 total citations. These appear in Biochemical Pharmacology, Journal of Cellular and Molecular Medicine, and Frontiers in Oncology. The research fields span bone healing with mesenchymal stem cells, osteogenic differentiation via Wnt/β-catenin signaling in osteoporosis, and immunosuppressive tumor microenvironment in hepatocellular carcinoma.
| Species | Application | Title |
|---|---|---|
Biochem Pharmacol Accelerating bone healing in femoral defect model using FBXO6-modified bone marrow-derived mesenchymal stem cells on a collagen scaffold. | ||
J Cell Mol Med STARD3NL inhibits the osteogenic differentiation by inactivating the Wnt/β-catenin pathway via binding to Annexin A2 in osteoporosis.
| ||
Front Oncol STARD3NL as a prognostic marker related to an immunosuppressive tumor microenvironment in hepatocellular carcinoma. |
Reviews
What customers say
One reviewer rated this antibody 5/5 stars after using it at a 1:500 dilution in Western Blot on RAW 264.7 mouse macrophage cells. They reported a single clear band and praised the availability of a small trial size, which allowed them to test the antibody before committing to a larger purchase. Overall, the feedback is highly positive, highlighting both the specificity and the convenient product sizing.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lianne (Verified Customer) (08-05-2025) | Fantastic antibody with a single clear band. Loved having the option to purchase a small, trial-size product, in order to test the antibody first.
 |
