STARD3NL Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• STARD3NL Polyclonal antibody, PBS Only (20502-1-PBS)

• 

  WB analysis using 20502-1-AP (same clone as 20502-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20502-1-AP (STARD3NL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20502-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 20502-1-AP (same clone as 20502-1-PBS)

  IP result of anti-STARD3NL (IP:20502-1-AP, 4ug; Detection:20502-1-AP 1:500) with HEK-293 cells lysate 3200ug. This data was developed using the same antibody clone with 20502-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 20502-1-AP (same clone as 20502-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 20502-1-AP (STARD3NL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20502-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 20502-1-AP (same clone as 20502-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 20502-1-AP (STARD3NL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20502-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 20502-1-AP (same clone as 20502-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using STARD3NL antibody (20502-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 20502-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

STARD3NL Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 20502-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

20502-1-PBS targets STARD3NL in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14273

  Product name: Recombinant human STARD3NL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 162-234 aa of BC005959

  Sequence: ILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL

• Full Name: STARD3 N-terminal like
• Calculated Molecular Weight: 234 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC005959
• Gene Symbol: STARD3NL
• Gene ID (NCBI): 83930
• RRID: AB_10694281
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95772
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.