STARD5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• STARD5 Polyclonal antibody, PBS Only (10487-1-PBS)

• 

  WB analysis of mouse liver using 10487-1-AP (same clone as 10487-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 10487-1-AP (STARD5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10487-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10487-1-AP (same clone as 10487-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10487-1-AP (STARD5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10487-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 10487-1-AP (same clone as 10487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 10487-1-AP (STARD5 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10487-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 10487-1-AP (same clone as 10487-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 10487-1-AP (STARD5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10487-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10487-1-AP (same clone as 10487-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using STARD5 antibody (10487-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 10487-1-PBS in a different storage buffer formulation.

STARD5 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10487-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

StAR-related lipid transfer protein 5, START domain-containing protein 5

---

Product Information

10487-1-PBS targets STARD5 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0753

  Product name: Recombinant human STARD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC004365

  Sequence: MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE

• Full Name: StAR-related lipid transfer (START) domain containing 5
• Calculated Molecular Weight: 23.4 kDa
• Observed Molecular Weight: 24-26 kDa
• GenBank Accession Number: BC004365
• Gene Symbol: STARD5
• Gene ID (NCBI): 80765
• RRID: AB_2197808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NSY2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.