STARD7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• STARD7 Polyclonal antibody, PBS Only (15689-1-PBS)

• 

  WB analysis using 15689-1-AP (same clone as 15689-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15689-1-AP (STARD7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15689-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15689-1-AP (same clone as 15689-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15689-1-AP (STARD7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15689-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 15689-1-AP (same clone as 15689-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15689-1-AP (STARD7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15689-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 15689-1-AP (same clone as 15689-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15689-1-AP (STARD7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15689-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

STARD7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15689-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

GTT1, StAR-related lipid transfer protein 7, mitochondrial, START domain-containing protein 7

---

Product Information

15689-1-PBS targets STARD7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8224

  Product name: Recombinant human STARD7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-295 aa of BC008894

  Sequence: MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEGSCGPARIEYA

• Full Name: StAR-related lipid transfer (START) domain containing 7
• Calculated Molecular Weight: 295 aa, 35 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC008894
• Gene Symbol: STARD7
• Gene ID (NCBI): 56910
• RRID: AB_2197820
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQZ5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STARD7, also known as gestational trophoblastic tumor gene-1 (GTT1), is a lipid transfer protein that specifically binds and transports phosphatidylcholine (PC) between cellular membranes. It is a member of the START (Steroidogenic Acute Regulatory protein-related lipid transfer) domain-containing protein family, which is involved in intracellular lipid transport and metabolism. (PMID: 23507753)