• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated STAT1 Recombinant monoclonal antibody

STAT1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-82016
Clone No.2F16

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

2F16, ISGF 3, Signal transducer and activator of transcription 1-alpha/beta, STAT91, Transcription factor ISGF-3 components p91/p84

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inIFN alpha treated HeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82016 targets STAT1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0199

Product name: Recombinant human STAT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-230 aa of BC002704

Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA

Predict reactive species
Full Name signal transducer and activator of transcription 1, 91kDa
Calculated Molecular Weight 83 kDa
Observed Molecular Weight 84 kDa
GenBank Accession NumberBC002704
Gene Symbol STAT1
Gene ID (NCBI) 6772
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42224
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

STAT1 (signal transducers and activators of transcription 1) is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. Various ligands, including interferons- and - , EGF, PDGF and IL-6, can activate STAT1. STAT1 protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 STAT1 antibody CL488-82016Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...