CoraLite® Plus 488-conjugated STAT1 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-82016

  Immunofluorescent analysis of (4% PFA) fixed IFN alpha treated HeLa cells using CoraLite® Plus 488 STAT1 antibody (CL488-82016, Clone: 2F16 ) at dilution of 1:200, CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

STAT1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-82016

Clone No.2F16

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

2F16, ISGF 3, Signal transducer and activator of transcription 1-alpha/beta, STAT91, Transcription factor ISGF-3 components p91/p84

---

Tested Applications

• Positive IF/ICC detected in: IFN alpha treated HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82016 targets STAT1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0199

  Product name: Recombinant human STAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-230 aa of BC002704

  Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA

• Full Name: signal transducer and activator of transcription 1, 91kDa
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 84 kDa
• GenBank Accession Number: BC002704
• Gene Symbol: STAT1
• Gene ID (NCBI): 6772
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42224
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

STAT1 (signal transducers and activators of transcription 1) is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. Various ligands, including interferons- and - , EGF, PDGF and IL-6, can activate STAT1. STAT1 protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens.