STAT4 Monoclonal antibody, PBS Only

• 

  WB analysis using 67568-2-Ig (same clone as 67568-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67568-2-Ig (STAT4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67568-2-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67568-2-Ig (same clone as 67568-2-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67568-2-Ig (STAT4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67568-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 67568-2-Ig (same clone as 67568-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67568-2-Ig (STAT4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67568-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67568-2-Ig (same clone as 67568-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67568-2-Ig (STAT4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67568-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67568-2-Ig (same clone as 67568-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67568-2-Ig (STAT4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67568-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 67568-2-Ig (same clone as 67568-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 67568-2-Ig (STAT4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67568-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 67568-2-Ig (same clone as 67568-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 67568-2-Ig (STAT4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67568-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67568-2-Ig (same clone as 67568-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using STAT4 antibody (67568-2-Ig, Clone: 4A8C9 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67568-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 67568-2-Ig (same clone as 67568-2-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug STAT4 Monoclonal antibody (67568-2-Ig, Clone:4A8C9) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67568-2-PBS in a different storage buffer formulation.

STAT4 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 67568-2-PBS

Clone No.4A8C9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

4A8C9, DPMC, SLEB11

---

Product Information

67568-2-PBS targets STAT4 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19545

  Product name: Recombinant human STAT4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 399-748 aa of BC031212

  Sequence: FRHLQPKEMKSSAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE

• Full Name: signal transducer and activator of transcription 4
• Calculated Molecular Weight: 748 aa, 86 kDa
• Observed Molecular Weight: 86 kDa
• GenBank Accession Number: BC031212
• Gene Symbol: STAT4
• Gene ID (NCBI): 6775
• RRID: AB_2882782
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14765
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The JAK/STAT pathway is an extensive signaling pathway downstream of cytokine receptors. STATs are cytosolic proteins with a common structure consisting of an N-terminal oligomerization domain, which favors formation of STAT dimers, followed by a DNA-binding domain and a C-terminal SRC homology-2 (SH2) domain, which is involved in association between STATs and receptors[PMID:22383755]. Signal Transducer and Activator of Transcription 4 (STAT4) is a transcription factor that is activated by IL-12 signaling and promotes Th1-cell differentiation and IFN-γ production [PMID:21998209].