Tested Applications
| Positive WB detected in | HeLa cells, 4T1 cells, HEK-293 cells, HepG2 cells, Jurkat cells, MOLT-4 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells |
| Positive IHC detected in | human cervical cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67568-2-Ig targets STAT4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19545 Product name: Recombinant human STAT4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 399-748 aa of BC031212 Sequence: FRHLQPKEMKSSAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE Predict reactive species |
| Full Name | signal transducer and activator of transcription 4 |
| Calculated Molecular Weight | 748 aa, 86 kDa |
| Observed Molecular Weight | 86 kDa |
| GenBank Accession Number | BC031212 |
| Gene Symbol | STAT4 |
| Gene ID (NCBI) | 6775 |
| RRID | AB_2882782 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q14765 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The JAK/STAT pathway is an extensive signaling pathway downstream of cytokine receptors. STATs are cytosolic proteins with a common structure consisting of an N-terminal oligomerization domain, which favors formation of STAT dimers, followed by a DNA-binding domain and a C-terminal SRC homology-2 (SH2) domain, which is involved in association between STATs and receptors[PMID:22383755]. Signal Transducer and Activator of Transcription 4 (STAT4) is a transcription factor that is activated by IL-12 signaling and promotes Th1-cell differentiation and IFN-γ production [PMID:21998209].
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for STAT4 antibody 67568-2-Ig | Download protocol |
| IF protocol for STAT4 antibody 67568-2-Ig | Download protocol |
| IHC protocol for STAT4 antibody 67568-2-Ig | Download protocol |
| WB protocol for STAT4 antibody 67568-2-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
STAT4 Monoclonal antibody (4A8C9), catalog number 67568-2-Ig, has 4 indexed citations published in Free Radical Biology and Medicine, Molecular Neurobiology, Journal of Oncology, and Immunology and Ageing. These studies span Sjögren's syndrome, cerebral ischemia, liver cancer metastasis, and rheumatoid arthritis, utilizing applications including immunofluorescence, Western blot, and immunohistochemistry in mouse, rat, and human samples.
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med Downregulated GPX4 in salivary gland epithelial cells contributes to salivary secretion dysfunction in Sjogren's syndrome via lipid ROS/pSTAT4/AQP5 axis | ||
Mol Neurobiol STAT4-Mediated Klotho Up-Regulation Contributes to the Brain Ischemic Tolerance by Cerebral Ischemic Preconditioning via Inhibiting Neuronal Pyroptosis | ||
J Oncol The Mechanism of miR-141 Regulating the Proliferation and Metastasis of Liver Cancer Cells by Targeting STAT4.
| ||
Immun Ageing IL-35 promotes synovial fibroblast senescence via activation of cGAS-STING-TBK1-IRF3 pathway in rheumatoid arthritis. |
Reviews
What customers say
One reviewer (Eric C.) rated this antibody 3/5 stars after using it at 1:1000 dilution on THP-1 cells for Western Blot and Immunoprecipitation (Lot 10027171). He confirmed the ~80 kDa band matches the expected molecular weight but noted unexpected lower bands and stated that a comparable antibody from another vendor produced much cleaner blots in his hands.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Eric (Verified Customer) (11-12-2025) | The band at around 80kDa is the expected molecular weight. I don't know what the lower bands are. My blots using Abclonal A4523 are much cleaner.
 |
