STAT6 70kDa Polyclonal antibody

• 

  WB analysis of HeLa using 10257-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10257-1-AP (STAT6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10257-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10257-1-AP (STAT6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human spleen using 10257-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 10257-1-AP (STAT6 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 10257-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 10257-1-AP (STAT6 antibody) at dilution of 1:50 (under 40x lens).

STAT6 70kDa Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10257-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

D12S1644, IL 4 STAT, STAT6, STAT6 70kDa, STAT6B, STAT6C

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

10257-1-AP targets STAT6 70kDa in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0410

  Product name: Recombinant human STAT6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 368-567 aa of BC005823

  Sequence: IKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDNNAKATILWYNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSE

• Full Name: signal transducer and activator of transcription 6, interleukin-4 induced
• Calculated Molecular Weight: 100 kDa
• Observed Molecular Weight: 75-80 kDa
• GenBank Accession Number: BC005823
• Gene Symbol: STAT6
• Gene ID (NCBI): 6778
• RRID: AB_10695044
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P42226
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STAT6, also named as Signal transducer and activator of transcription 6, is a 847 amino acid protein, which belongs to the transcription factor STAT family. STAT6 forms a homodimer or a heterodimer with a related family member. STAT6 translocates into the nucleus in response to phosphorylation. STAT6 is Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling. This poly-antibody only recognizes 70 kDa isoform of STAT6.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Front Pharmacol; Isovitexin Inhibits Ginkgolic Acids-Induced Inflammation Through Downregulating SHP2 Activation.; Authors - Yiwei Zhang
rat	WB	Pharm Biol; Yiguanjian decoction inhibits macrophage M1 polarization and attenuates hepatic fibrosis induced by CCl4/2-AAF.; Authors - Ying Xu