STAT6 Monoclonal antibody, PBS Only

• 

  WB analysis using 66717-1-Ig (same clone as 66717-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66717-1-Ig (STAT6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 66717-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66717-1-Ig (same clone as 66717-1-PBS)

  WB result of STAT6 antibody (66717-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-STAT6 transfected HeLa cells. This data was developed using the same antibody clone with 66717-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66717-1-Ig (same clone as 66717-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66717-1-Ig (STAT6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 66717-1-Ig (same clone as 66717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66717-1-Ig (STAT6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 66717-1-Ig (same clone as 66717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 66717-1-Ig (STAT6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 66717-1-Ig (same clone as 66717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66717-1-Ig (STAT6 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66717-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendicitis using 66717-1-Ig (same clone as 66717-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66717-1-Ig (STAT6 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66717-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

STAT6 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66717-1-PBS

Clone No.2E5B8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

2E5B8, IL-4 Stat, Signal transducer and activator of transcription 6, STAT 6, STAT6B

---

Product Information

66717-1-PBS targets STAT6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0410

  Product name: Recombinant human STAT6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 368-567 aa of BC005823

  Sequence: IKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDNNAKATILWYNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSE

• Full Name: signal transducer and activator of transcription 6, interleukin-4 induced
• Calculated Molecular Weight: 100 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC005823
• Gene Symbol: STAT6
• Gene ID (NCBI): 6778
• RRID: AB_2882068
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42226
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STAT6, also named as Signal transducer and activator of transcription 6, is a 847 amino acid protein, which belongs to the transcription factor STAT family. STAT6 forms a homodimer or a heterodimer with a related family member. STAT6 translocates into the nucleus in response to phosphorylation. STAT6 is Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling.