STEAP3 Recombinant monoclonal antibody, PBS Only

STEAP3 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83484-2-PBS
Clone No.1N5

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, FC (Intra), ELISA

1N5, dudlin 2, Dudulin 2, Dudulin-2, EC:1.16.1.-

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83484-2-PBS targets STEAP3 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29528

Product name: Recombinant human STEAP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 60-130 aa of BC042150

Sequence: NPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNA

Predict reactive species
Full Name STEAP family member 3
Calculated Molecular Weight 488 aa, 55 kDa
Observed Molecular Weight55 kDa
GenBank Accession NumberBC042150
Gene Symbol STEAP3
Gene ID (NCBI) 55240
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ658P3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

STEAP3 (Six-Transmembrane Epithelial Antigen of Prostate 3) is also named as TSAP6, Dudulin-2 and pHyde, and belongs to the STEAP family. STEAP3 is a member of the STEAP family and is composed of a six-transmembrane domain at the COOH-terminal domain and a cytoplasmic N-terminal oxidoreductase domain, which is essential for iron and copper uptake (PMID:16227996). STEAP3 contains a functional p53-binding site in its promoter and can be upregulated following p53 activation to enhance cell death in myeloid leukemia cell line and breast cancer cells (PMID: 18617898). By interacting with Nix, a pro-apoptotic Bcl-2 family member, and Myt1 kinase, a negative regulator of the G2/M transition, STEAP3 overexpression promotes apoptosis and inhibits G2/M transition in cell cycle progression (PMID: 12606722, PMID: 10504341).

Loading...
||
New chat Able
正在加载,请稍候...