STEAP3 Recombinant monoclonal antibody

STEAP3 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83484-2-RR
Clone No.1N5

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, FC (Intra), ELISA

dudlin 2, Dudulin 2, Dudulin-2, EC:1.16.1.-, hpHyde

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, PC-12 cells, C6 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83484-2-RR targets STEAP3 in WB, FC (Intra), ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29528

Product name: Recombinant human STEAP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 60-130 aa of BC042150

Sequence: NPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNA

Predict reactive species
Full Name STEAP family member 3
Calculated Molecular Weight 488 aa, 55 kDa
Observed Molecular Weight 55 kDa
GenBank Accession NumberBC042150
Gene Symbol STEAP3
Gene ID (NCBI) 55240
RRIDAB_3671112
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ658P3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STEAP3 (Six-Transmembrane Epithelial Antigen of Prostate 3) is also named as TSAP6, Dudulin-2 and pHyde, and belongs to the STEAP family. STEAP3 is a member of the STEAP family and is composed of a six-transmembrane domain at the COOH-terminal domain and a cytoplasmic N-terminal oxidoreductase domain, which is essential for iron and copper uptake (PMID:16227996). STEAP3 contains a functional p53-binding site in its promoter and can be upregulated following p53 activation to enhance cell death in myeloid leukemia cell line and breast cancer cells (PMID: 18617898). By interacting with Nix, a pro-apoptotic Bcl-2 family member, and Myt1 kinase, a negative regulator of the G2/M transition, STEAP3 overexpression promotes apoptosis and inhibits G2/M transition in cell cycle progression (PMID: 12606722, PMID: 10504341).

Protocols

Product Specific Protocols
FC protocol for STEAP3 antibody 83484-2-RRDownload protocol
WB protocol for STEAP3 antibody 83484-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...