STIL Monoclonal antibody, PBS Only

• 

  WB analysis using 66876-1-Ig (same clone as 66876-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66876-1-Ig (STIL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66876-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66876-1-Ig (same clone as 66876-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66876-1-Ig (STIL antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66876-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66876-1-Ig (same clone as 66876-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66876-1-Ig (STIL antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66876-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66876-1-Ig (same clone as 66876-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66876-1-Ig (STIL antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66876-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66876-1-Ig (same clone as 66876-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66876-1-Ig (STIL antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66876-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 66876-1-Ig (same clone as 66876-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using STIL antibody (66876-1-Ig, Clone: 1E12C1 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 66876-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 66876-1-Ig (same clone as 66876-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using STIL antibody (66876-1-Ig, Clone: 1E12C1 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 66876-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

STIL Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66876-1-PBS

Clone No.1E12C1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1E12C1, SCL-interrupting locus protein, SIL, TAL-1-interrupting locus protein

---

Product Information

66876-1-PBS targets STIL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19124

  Product name: Recombinant human STIL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 928-1277 aa of BC126223

  Sequence: LHQPSDNQKIYQDLLGQVNHLLNSSSKETEQPSTKAVIISHECTRTQNVYHTKKKTHHSRLVDKDCVLNATLKQLRSLGVKIDSPTKVKKNAHNVDHASVLACISPEAVISGLNCMSFANVGMSGLSPNGVDLSMEANAIALKYLNENQLSQLSVTRSNQNNCDPFSLLHINTDRSTVGLSLISPNNMSFATKKYMKRYGLLQSSDNSEDEEEPPDNADSKSEYLLNQNLRSIPEQLGGQKEPSKNDHEIINCSNCESVGTNADTPVLRNITNEVLQTKAKQQLTEKPAFLVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSETLKQMNSMNSVGTFLDV

• Full Name: SCL/TAL1 interrupting locus
• Calculated Molecular Weight: 1287 aa, 143 kDa
• Observed Molecular Weight: 150-155 kDa
• GenBank Accession Number: BC126223
• Gene Symbol: STIL
• Gene ID (NCBI): 6491
• RRID: AB_2882210
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15468
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.