STIM2 Recombinant monoclonal antibody

• 

  WB analysis using 85727-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85727-1-RR (STIM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 85727-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85727-1-RR against Human STIM2 were performed. The affinity constant is 0.774 nM.

STIM2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85727-1-RR

Clone No.250016E8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KIAA1482, Stromal interaction molecule 2

---

Tested Applications

• Positive WB detected in: Jurkat cells, BxPC-3 cells, HepG2 cells, HEK-293 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85727-1-RR targets STIM2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15530

  Product name: Recombinant human STIM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 525-674 aa of BC146661

  Sequence: EKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGGVDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHHPQHTPHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAEKQ

• Full Name: stromal interaction molecule 2
• Calculated Molecular Weight: 754 aa, 85 kDa
• Observed Molecular Weight: 85-115 kDa
• GenBank Accession Number: BC146661
• Gene Symbol: STIM2
• Gene ID (NCBI): 57620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9P246
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STIM2, also named as KIAA1482, functions as a highly sensitive Ca2+ sensor in the endoplasmic reticulum which activates both store-operated and store-independent Ca2+-influx. Regulates basal cytosolic and endoplasmic reticulum Ca2+ concentrations. Upon mild variations of the endoplasmic reticulum Ca2+ concentration, STIM2 translocates from the endoplasmic reticulum to the plasma membrane where it probably activates the Ca2+ release-activated Ca2+ (CRAC) channels ORAI1, ORAI2 and ORAI3. STIM2 may inhibit STIM1-mediated Ca2+ influx. STIM2 has 2 isoforms 105kd and 115kd with Differential levels of phosphorylation.