• Featured Product
  • KD/KO Validated

STIP1 Monoclonal antibody, PBS Only

STIP1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA
Cat No. 68155-1-PBS
Clone No.1B5H2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Hop, Hsc70/Hsp90 organizing protein, Hsc70/Hsp90-organizing protein, IEF SSP 3521, P60

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68155-1-PBS targets STIP1 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7851

Product name: Recombinant human STIP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 195-543 aa of BC002987

Sequence: EIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR

Predict reactive species
Full Name stress-induced-phosphoprotein 1
Calculated Molecular Weight 63 kDa
Observed Molecular Weight61 kDa
GenBank Accession NumberBC002987
Gene Symbol STIP1
Gene ID (NCBI) 10963
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP31948
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

STIP1, also named as Hop and NY-REN-11. Its expression is low in the hypothalamus. STIP1 has some isoforms with MW 62 kDa, 68 kDa and 59 kDa. Acts as a co-chaperone for HSP90AA1.Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90, Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones STIP1/HOP, CDC37, PPP5C, PTGES3/p23, TSC1 and client protein TSC2. STIP1 interacts with PACRG, EEF1AKMT3, FLCN, FNIP1 and FNIP2 (PMID:24880080).

Loading...
||
New chat Able
正在加载,请稍候...