• Featured Product
  • KD/KO Validated

STIP1 Monoclonal antibody

STIP1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 68155-1-Ig
Clone No.1B5H2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Hop, Hsc70/Hsp90 organizing protein, Hsc70/Hsp90-organizing protein, IEF SSP 3521, P60

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HEK-293 cells, LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
Positive IP detected inHeLa cells, Jurkat cells
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68155-1-Ig targets STIP1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7851

Product name: Recombinant human STIP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 195-543 aa of BC002987

Sequence: EIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR

Predict reactive species
Full Name stress-induced-phosphoprotein 1
Calculated Molecular Weight 63 kDa
Observed Molecular Weight61 kDa
GenBank Accession NumberBC002987
Gene Symbol STIP1
Gene ID (NCBI) 10963
RRIDAB_2935260
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP31948
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STIP1, also named as Hop and NY-REN-11. Its expression is low in the hypothalamus. STIP1 has some isoforms with MW 62 kDa, 68 kDa and 59 kDa. Acts as a co-chaperone for HSP90AA1.Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90, Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones STIP1/HOP, CDC37, PPP5C, PTGES3/p23, TSC1 and client protein TSC2. STIP1 interacts with PACRG, EEF1AKMT3, FLCN, FNIP1 and FNIP2 (PMID:24880080).

Protocols

Product Specific Protocols
FC protocol for STIP1 antibody 68155-1-IgDownload protocol
IF protocol for STIP1 antibody 68155-1-IgDownload protocol
IHC protocol for STIP1 antibody 68155-1-IgDownload protocol
IP protocol for STIP1 antibody 68155-1-IgDownload protocol
WB protocol for STIP1 antibody 68155-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...