STIP1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• STIP1 Monoclonal antibody (68155-1-Ig)

• Featured Product
• KD/KO Validated

STIP1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 68155-1-Ig

Clone No.1B5H2

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

Hop, Hsc70/Hsp90 organizing protein, Hsc70/Hsp90-organizing protein, IEF SSP 3521, P60

• 

  WB analysis using 68155-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68155-1-Ig (STIP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 68155-1-Ig

  WB result of STIP1 antibody (68155-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-STIP1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 68155-1-Ig

  IP result of anti-STIP1 (IP:68155-1-Ig, 5ug; Detection:68155-1-Ig 1:1000) with HeLa cells lysate 1880 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 68155-1-Ig

  IP result of anti-STIP1 (IP:68155-1-Ig, 5ug; Detection:68155-1-Ig 1:1000) with Jurkat cells lysate 2400 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 68155-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68155-1-Ig (STIP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 68155-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 68155-1-Ig (STIP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 68155-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using STIP1 antibody (68155-1-Ig, Clone: 1B5H2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 68155-1-Ig

  1x10^6 MCF-7 cells were intracellularly stained with 0.4 ug STIP1 Monoclonal antibody (68155-1-Ig, Clone:1B5H2) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.4 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IP detected in: HeLa cells, Jurkat cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68155-1-Ig targets STIP1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7851

  Product name: Recombinant human STIP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 195-543 aa of BC002987

  Sequence: EIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR

• Full Name: stress-induced-phosphoprotein 1
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC002987
• Gene Symbol: STIP1
• Gene ID (NCBI): 10963
• RRID: AB_2935260
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P31948
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STIP1, also named as Hop and NY-REN-11. Its expression is low in the hypothalamus. STIP1 has some isoforms with MW 62 kDa, 68 kDa and 59 kDa. Acts as a co-chaperone for HSP90AA1.Mediates the association of the molecular chaperones HSPA8/HSC70 and HSP90, Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones STIP1/HOP, CDC37, PPP5C, PTGES3/p23, TSC1 and client protein TSC2. STIP1 interacts with PACRG, EEF1AKMT3, FLCN, FNIP1 and FNIP2 (PMID:24880080).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Exploration (Beijing); STIP1 drives Metabolic Reprogramming in Esophageal Squamous Cell Carcinoma via AHCY-LDHA Axis.; Authors - Guoguo Jin ; KD Validated