STRADB Polyclonal antibody

STRADB Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10688-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ALS2CR2, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein, CALS 21, ILP interacting protein, ILP-interacting protein

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of Raji using 10688-1-AP
Raji cells were subjected to SDS PAGE followed by western blot with 10688-1-AP (STRADB Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse heart using 10688-1-AP
mouse heart tissue were subjected to SDS PAGE followed by western blot with 10688-1-AP (STRADB Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 10688-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 10688-1-AP (STRADB Antibody) at dilution of 1:200 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 10688-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 10688-1-AP (STRADB Antibody) at dilution of 1:200 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 10688-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 10688-1-AP (STRADB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human rectal cancer using 10688-1-AP
Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 10688-1-AP (STRADB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 10688-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10688-1-AP (STRADB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse pancreas using 10688-1-AP
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 10688-1-AP (STRADB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 10688-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 10688-1-AP (STRADB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat liver using 10688-1-AP
Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 10688-1-AP (STRADB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Raji cells, mouse heart tissue
Positive IHC detected in	human heart tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:200-1:1000
Immunohistochemistry (IHC)	IHC : 1:100-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10688-1-AP targets STRADB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1040 Product name: Recombinant human STRADB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 119-418 aa of BC008302 Sequence: ITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQNGCIHRSIKASHILISGDGLVTLSGLSHLHSLVKHGQRHRAVYDFPQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF Predict reactive species
Full Name	STE20-related kinase adaptor beta
Calculated Molecular Weight	47 kDa
Observed Molecular Weight	28-31 kDa, 38-42 kDa
GenBank Accession Number	BC008302
Gene Symbol	STRADB
Gene ID (NCBI)	55437
RRID	AB_2197715
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9C0K7
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The 418 amino acid STRADB protein, which is also named as ALS2CR2 and ILPIP, contains a putative N-terminal ATP-binding site, a protein kinase domain, and several C-terminal phosphorylation sites. STRADB potentiates the antiapoptotic activity of XIAP by enhancing XIAP-mediated activation of JNK1 and other JNK family members, but not by modulating XIAP-mediated caspase inhibition. This protein has 3 isoforms produced by alternative splicing with the MW of 47 kDa, 42 kDa and 31 kDa.