Tested Applications
| Positive WB detected in | A549 cells, rat brain tissue, NIH/3T3 cells, mouse brain tissue, HEK-293T cells, HeLa cells, Jurkat cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | Hela cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21624-1-AP targets STRN in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15984 Product name: Recombinant human STRN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 301-403 aa of BC106879 Sequence: NRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLTYDIANNKDALRKT Predict reactive species |
| Full Name | striatin, calmodulin binding protein |
| Calculated Molecular Weight | 780 aa, 86 kDa |
| Observed Molecular Weight | 110 kDa |
| GenBank Accession Number | BC106879 |
| Gene Symbol | STRN |
| Gene ID (NCBI) | 6801 |
| RRID | AB_10863122 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43815 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
STRN (Striatin), a 780-amino acid protein, was identified and cloned more than a decade ago. In adult mammals, striatin is mainly expressed in neurons of both the central and peripheral nervous systems with very high levels of expression in the striatum, hence its name. STRN-ALK fusion may be a potential therapeutic target in the aggressive forms of thyroid cancer (PMID: 24475247).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for STRN antibody 21624-1-AP | Download protocol |
| IF protocol for STRN antibody 21624-1-AP | Download protocol |
| IHC protocol for STRN antibody 21624-1-AP | Download protocol |
| IP protocol for STRN antibody 21624-1-AP | Download protocol |
| WB protocol for STRN antibody 21624-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-STRN antibody (catalog 21624-1-AP) has 7 citations. They appear in Frontiers in Cell and Developmental Biology, Bioorganic Chemistry, Scientific Reports, Journal of Biological Chemistry, Genes (Basel), Kaohsiung Journal of Medical Sciences, and Biomedical Research International. Research fields span hearing and inner hair cell biology, PP2A/inflammation, functional dyspepsia, metallothionein regulation, polysubstance use, and hepatocellular carcinoma progression and epithelial-mesenchymal transition.
| Species | Application | Title |
|---|---|---|
Front Cell Dev Biol Striatin Is Required for Hearing and Affects Inner Hair Cells and Ribbon Synapses.
| ||
Bioorg Chem Covalent targeting of PP2A scaffold subunit PPP2R1A by Pseudolarolide B enhances holoenzyme assembly to exert anti-inflammatory activity. | ||
Sci Rep Precise and systematic survey of the efficacy of multicomponent drugs against functional dyspepsia. | ||
J Biol Chem Heavy Metal-Induced Metallothionein Expression is Regulated by Specific Protein Phosphatase 2A Complexes. | ||
Genes (Basel) Effect of Combined Methamphetamine and Oxycodone Use on the Synaptic Proteome in an In Vitro Model of Polysubstance Use | ||
Kaohsiung J Med Sci CircTNPO3 promotes hepatocellular carcinoma progression by sponging miR-199b-5p and regulating STRN expression |
Reviews
What customers say
The single review for this product is a 5-star rating. The reviewer used it at a 1:1000 dilution for Western Blot on primary rat neurons and described it as a great antibody for cell lysates. Overall, the feedback is positive, highlighting its strong performance in detecting the target in lysate samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Vicki (Verified Customer) (02-21-2022) | Great antibody for cell lysates
|
