• Featured Product
  • KD/KO Validated

STUB1 Polyclonal antibody

STUB1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 29751-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

CHIP, Antigen NY-CO-7, Carboxy terminus of Hsp70-interacting protein, CLL-associated antigen KW-8, E3 ubiquitin-protein ligase CHIP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, HEK-293 cells, NIH/3T3 cells, PC-12 cells, mouse kidney tissue, rat kidney tissue
Positive IHC detected inrat lung tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29751-1-AP targets STUB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31335

Product name: Recombinant human STUB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 73-303 aa of BC007545

Sequence: MQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Predict reactive species
Full Name STIP1 homology and U-box containing protein 1
Observed Molecular Weight35 kDa
GenBank Accession NumberBC007545
Gene Symbol STUB1
Gene ID (NCBI) 10273
RRIDAB_2923603
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UNE7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STUB1, also named as CHIP, SDCCAG7, UBOX1 and NY-CO-7, is a E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation. STUB1/CHIP modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation. STUB1/CHIP mediates polyubiquitination of CYP3A4.(PMID:10330192) CHIP/STUB1 strongly reduced keratin aggregates through increased degradation of mutant K14. (PMID:20151404) STUB1/CHIP regulates NAD(P)H:quinone oxidoreductase 1 (NQO1) accumulation in aged brain, a process impaired in certain Alzheimer patients.(PMID:21220432 )

Protocols

Product Specific Protocols
IHC protocol for STUB1 antibody 29751-1-APDownload protocol
WB protocol for STUB1 antibody 29751-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...