STX17 Recombinant monoclonal antibody

• 

  WB analysis using 81899-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81899-1-RR (STX17 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 81899-1-RR

  WB result of STX17 antibody (81899-1-RR; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-STX17 transfected HepG2 cells.

• 

  IHC staining of mouse kidney using 81899-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 81899-1-RR (STX17 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 81899-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 81899-1-RR (STX17 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 81899-1-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using STX17 antibody (81899-1-RR, Clone: 4G3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  Affinity and Kinetic Characterization of 81899-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81899-1-RR against Human STX17 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

STX17 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 81899-1-RR

Clone No.4G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Syntaxin-17, Syntaxin 17, 4G3

---

Tested Applications

• Positive WB detected in: human testis tissue, HepG2 cells, A375 cells, HEK-293 cells, L02 cells, mouse testis issue, rat testis tissue
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81899-1-RR targets STX17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12134

  Product name: Recombinant human STX17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-216 aa of BC111009

  Sequence: MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCGIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEE

• Full Name: syntaxin 17
• Calculated Molecular Weight: 302 aa, 33 kDa
• Observed Molecular Weight: 33-35 kD
• GenBank Accession Number: BC111009
• Gene Symbol: STX17
• Gene ID (NCBI): 55014
• RRID: AB_2935590
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56962
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for the fusion of cellular membranes. Syntaxin 17 (STX17) is a SNARE of the autophagosome involved in autophagy through the direct control of autophagosome membrane fusion with the lysosome membrane. STX17 may also play a role in the early secretory pathway where it may maintain the architecture of the endoplasmic reticulum-Golgi intermediate compartment/ERGIC and Golgi and/or regulate transport between the endoplasmic reticulum, the ERGIC and the Golgi.