• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated STX17 Recombinant monoclonal antibody

STX17 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-81899
Clone No.4G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

4G3, Syntaxin 17, Syntaxin-17

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-81899 targets STX17 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12134

Product name: Recombinant human STX17 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-216 aa of BC111009

Sequence: MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCGIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEE

Predict reactive species
Full Name syntaxin 17
Calculated Molecular Weight 302 aa, 33 kDa
Observed Molecular Weight 33-35 kD
GenBank Accession NumberBC111009
Gene Symbol STX17
Gene ID (NCBI) 55014
RRIDAB_3673058
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56962
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. Syntaxin 17 (STX17) is a SNARE of the autophagosome involved in autophagy through the direct control of autophagosome membrane fusion with the lysosome membrane. STX17 may also play a role in the early secretory pathway where it may maintain the architecture of the endoplasmic reticulum-Golgi intermediate compartment/ERGIC and Golgi and/or regulate transport between the endoplasmic reticulum, the ERGIC and the Golgi.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 STX17 antibody CL488-81899Download protocol
IF protocol for CL Plus 488 STX17 antibody CL488-81899Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...