• Featured Product
  • KD/KO Validated

SUB1 Polyclonal antibody

SUB1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 10948-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

RPO2TC1, Positive cofactor 4, PC4, P15, p14

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, A549 cells
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10948-2-AP targets SUB1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1390

Product name: Recombinant human SUB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-127 aa of BC009610

Sequence: MPKSKELVSSGSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

Predict reactive species
Full Name SUB1 homolog (S. cerevisiae)
Calculated Molecular Weight 14 kDa
Observed Molecular Weight 18-23 kDa
GenBank Accession NumberBC009610
Gene Symbol SUB1
Gene ID (NCBI) 10923
RRIDAB_2255452
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP53999
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SUB1 gene encodes activated RNA polymerase II transcriptional coactivator p15, also termed as positive cofactor 4 (PC4) or p14. SUB1 is a sort of general coactivator that functions in assembling and stablization of transcription complex. It has DNA binding activity and is localized in the nucleus, mulitple modification sites of phosphorylation or acetylation may turn it appear slightly shifted molecular weight. Catalog#10948-2-AP is a rabbit polyclonal antibody raised against full-length human SUB1. This antibody recognize 14-16 kDa (P14 or P15), 20 kDa(phospho form) and 30 kDa (Dimer form).

Protocols

Product Specific Protocols
IF protocol for SUB1 antibody 10948-2-APDownload protocol
IHC protocol for SUB1 antibody 10948-2-APDownload protocol
WB protocol for SUB1 antibody 10948-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IHC

J Proteome Res

Novel breast cancer metastasis-associated proteins.

Authors - Ho Jiapei J
mouseWB

J Cell Biochem

Knockdown of nucleosome assembly protein 1-like 1 promotes dimethyl sulfoxide-induced differentiation of P19CL6 cells into cardiomyocytes.

Authors - Li Lu L

Biosaf Health

Comprehensive interactome analysis of the spike protein of swine acute diarrhea syndrome coronavirus.

Authors - Qingxing Wang
human,mouseWB,IHC,IF,CoIP

Sci China Life Sci

SUB1 promotes colorectal cancer metastasis by activating NF-κB signaling via UBR5-mediated ubiquitination of UBXN1

Authors - Hao Wang
  • KO Validated
humanWB

J Am Chem Soc

HMGB3 and SUB1 Bind to and Facilitate the Repair of N2-Alkylguanine Lesions in DNA

Authors - Ting Zhao
  • KO Validated
Loading...
||
New chat Able
正在加载,请稍候...