SUDS3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SUDS3 Polyclonal antibody, PBS Only (25845-1-PBS)

• 

  WB analysis of Raji using 25845-1-AP (same clone as 25845-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 25845-1-AP (SUDS3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25845-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 25845-1-AP (same clone as 25845-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 25845-1-AP (SUDS3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25845-1-PBS in a different storage buffer formulation.

SUDS3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25845-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25845-1-PBS targets SUDS3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22961

  Product name: Recombinant human SUDS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC112000

  Sequence: ELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYLLTDEQIMEDLRTLNKLKSPKRPASPSSPEHLPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCVISSVGANEIWVRKTSDSTKMRIYLGQLQRGLFVIRRRSAA

• Full Name: suppressor of defective silencing 3 homolog (S. cerevisiae)
• Calculated Molecular Weight: 328 aa, 38 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC112000
• Gene Symbol: SUDS3
• Gene ID (NCBI): 64426
• RRID: AB_2880265
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H7L9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SUDS3 (Sin3 histone deacetylase corepressor complex component SDS3), also known as SAP45 andSDS3, is a component of the Sin3 histone deacetylase corepressor complex. In this complex SDS3 interacts with SIN3A to regulate gene expression via chromatin modification. SUDS3 represses transcription and augments histone deacetylase activity of HDAC1. It may have a potential role in tumor suppressor pathways through regulation of apoptosis.