SULT1C4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SULT1C4 Polyclonal antibody, PBS Only (14300-1-PBS)

• 

  WB analysis using 14300-1-AP (same clone as 14300-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14300-1-AP (SULT1C4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14300-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14300-1-AP (same clone as 14300-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14300-1-AP (SULT1C4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14300-1-PBS in a different storage buffer formulation.

SULT1C4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14300-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:2.8.2.1, ST1C4, Sulfotransferase 1C4, SULT1C2

---

Product Information

14300-1-PBS targets SULT1C4 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5259

  Product name: Recombinant human SULT1C4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of BC058861

  Sequence: MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK

• Full Name: sulfotransferase family, cytosolic, 1C, member 4
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC058861
• Gene Symbol: SULT1C4
• Gene ID (NCBI): 27233
• RRID: AB_3741855
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75897
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SULT1C4 (Sulfotransferase 1C4), a member of a gene subfamily that includes three human members, SULT1C2, 1C3, and 1C4, is a dimeric Phase II drug-metabolizing enzyme primarily expressed in the developing fetus. SULT1C4 transcript is expressed in human intestinal and hepatic cell lines as well as in human liver specimens from different developmental stages, while SULT1C4 protein is barely detectable (PMID: 28222028, 32303576).