SUMO1 Polyclonal antibody, PBS Only

SUMO1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA
Cat No. 10329-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Small ubiquitin-related modifier 1, Small ubiquitin related modifier 1, Sentrin, OK/SW-cl.43, GMP1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

10329-1-PBS targets SUMO1 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0414

Product name: Recombinant human SUMO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-103 aa of BC006462

Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

Predict reactive species
Full Name SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae)
Calculated Molecular Weight 12 kDa
Observed Molecular Weight12~18 kDa, 80-90 kDa
GenBank Accession NumberBC006462
Gene Symbol SUMO1
Gene ID (NCBI) 7341
RRIDAB_2286872
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP63165
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Small ubiquitin-related modifier 1 (SUMO1) belongs to the ubiquitin family and the SUMO subfamily as it contains 1 ubiquitin-like domain and is also 18% identical to ubiquitin (PMID: 9654451).

1. What is the molecular weight of SUMO1?

The molecular weight of SUMO1 is 12 kDa.

2. What is the cellular localization of SUMO1?

SUMO1 is located in the nuclear membrane and is recruited by BCL11A to the nuclear body (PMID: 18681895).

3. What modifications is SUMO1 subjected to?

SUMO1 function occurs after the cleavage of its precursor form by SENP1 or SENP2 (PMID: 27576863). Polymeric SUMO1 chains also undergo polyubiquitination by RNF4 (PMID: 18408734).

4. What is the function of SUMO1?

SUMO1 post-translationally modifies many proteins that have roles in an array of processes including transcriptional regulation, chromatin structure, and DNA repair. SUMO1 can covalently attach itself to protein as a monomer or a lysine-linked polymer via an isopeptide bond (PMID:11124955). This SUMO modification can regulate the localization and activity of the affected proteins.

5. What is SUMO1's involvement in disease?

Defects in SUMO1 as a result of a chromosomal translocation are associated with non-syndromic orofacial cleft type 10, or non-syndromic cleft lip, and are associated with cleft palate in two-thirds of cases (PMID: 18983974).


Loading...
||
New chat Able
正在加载,请稍候...