Use Able AI chat for product recommendations

SUMO1 Recombinant monoclonal antibody, PBS Only

SUMO1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87942-1-PBS
Clone No.253578A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

GAP-modifying protein 1, GMP1, OK/SW-cl.43, Sentrin, Small ubiquitin related modifier 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87942-1-PBS targets SUMO1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0414

Product name: Recombinant human SUMO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-101 aa of BC006462

Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

Predict reactive species
Full Name SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae)
Calculated Molecular Weight 12 kDa
Observed Molecular Weight12~18 kDa, 80-90 kDa
GenBank Accession NumberBC006462
Gene Symbol SUMO1
Gene ID (NCBI) 7341
RRIDAB_3745834
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP63165
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms.This antibody can detect endogenous levels of SUMOylated proteins (e.g. SUMO-1-RanGAP at 80-90 kD).

Loading...
||
New chat

Able

正在加载,请稍候...