Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, A549 cells, Jurkat cells, U2OS cells, NIH/3T3 cells, PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
87942-1-RR targets SUMO1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0414 Product name: Recombinant human SUMO1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC006462 Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV Predict reactive species |
| Full Name | SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12~18 kDa, 80-90 kDa |
| GenBank Accession Number | BC006462 |
| Gene Symbol | SUMO1 |
| Gene ID (NCBI) | 7341 |
| RRID | AB_3745834 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P63165 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms.This antibody can detect endogenous levels of SUMOylated proteins (e.g. SUMO-1-RanGAP at 80-90 kD).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SUMO1 antibody 87942-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

