• Featured Product
  • KD/KO Validated

SUMO2/3 Monoclonal antibody

SUMO2/3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67154-1-Ig
Clone No.1A1B3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

SUMO2, Small ubiquitin-related modifier 2, Sentrin-2, Sentrin2, Sentrin 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, Jurkat cells, A549 cells, NIH/3T3 cells, K-562 cells, HSC-T6 cells, PC-12 cells
Positive IHC detected inhuman prostate cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67154-1-Ig targets SUMO2/3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28672

Product name: Recombinant human SUMO2/3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-95 aa of BC008450

Sequence: MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Predict reactive species
Full Name SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
Calculated Molecular Weight 11 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC008450
Gene Symbol SUMO2
Gene ID (NCBI) 6613
RRIDAB_2882451
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP61956
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms.

Protocols

Product Specific Protocols
IF protocol for SUMO2/3 antibody 67154-1-IgDownload protocol
IHC protocol for SUMO2/3 antibody 67154-1-IgDownload protocol
WB protocol for SUMO2/3 antibody 67154-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Commun

BioE3 identifies specific substrates of ubiquitin E3 ligases

Authors - Orhi Barroso-Gomila
humanWB

Nat Cell Biol

Transcription-coupled DNA-protein crosslink repair by CSB and CRL4CSA-mediated degradation

Authors - Marjolein van Sluis
humanIHC

Discov Oncol

SUMO2 inhibits ACSL3 protein degradation to antagonize erastin-induced ferroptosis in hepatocellular carcinoma

Authors - Yanxi Shen
Loading...
||
New chat Able
正在加载,请稍候...