• Featured Product
  • KD/KO Validated

CoraLite®555-conjugated SUMO2/3 Monoclonal antibody

SUMO2/3 Monoclonal Antibody for FC (Intra)
Cat No. CL555-67154
Clone No.1A1B3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat

Applications

FC (Intra)

SUMO2, Small ubiquitin-related modifier 2, Sentrin-2, Sentrin2, Sentrin 2

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-67154 targets SUMO2/3 in FC (Intra) applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28672

Product name: Recombinant human SUMO2/3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-95 aa of BC008450

Sequence: MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Predict reactive species
Full Name SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
Calculated Molecular Weight 11 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC008450
Gene Symbol SUMO2
Gene ID (NCBI) 6613
RRIDAB_2923899
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP61956
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms.

Protocols

Product Specific Protocols
FC protocol for CL555 SUMO2/3 antibody CL555-67154Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...