SUMO2/3 Recombinant monoclonal antibody, PBS Only

SUMO2/3 Uni-rAb® Recombinant Antibody for IF/ICC, Indirect ELISA
Cat No. 84017-5-PBS
Clone No.241156E1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

SUMO3, SUMO 2, SMT3H1, SMT3A, SMT3 homolog 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84017-5-PBS targets SUMO2/3 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1135

Product name: Recombinant human SUMO3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-103 aa of BC008420

Sequence: MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Predict reactive species
Full Name SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae)
Calculated Molecular Weight 12 kDa
GenBank Accession NumberBC008420
Gene Symbol SUMO3
Gene ID (NCBI) 6612
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP55854
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Ubiquitin is most famous for its function in targeting proteins for degradation by the 26S proteasome, ubiquitin needs to be attached to a substrate in chains (polyubiquitylation) before being recognized by proteasome. Similarly, SUMO (small ubiquitin-related modifier) can be linked to substrates in chains (polysumoylation), SUMO modification has been implicated in many important cellular processes including the control of genome stability, signal transduction, targeting to and formation of nuclear compartments, cell cycle and meiosis. There are 4 confirmed SUMO isoforms in human, SUMO-1, SUMO-2, SUMO-3 and SUMO-4. SUMO-2 and SUMO-3 are nearly identical but are distinct from SUMO-1. SUMO2/3 conjugation was recently widely involved in neuroprotective activities. A substitution (M55V) of SUMO4 was strongly associated with the pathogenesis of type 1 diabetes (T1D) involving NF kappa B related mechanisms.

Loading...
||
New chat Able
正在加载,请稍候...