SUPT6H Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SUPT6H Polyclonal antibody, PBS Only (23073-1-PBS)

• 

  WB analysis of HeLa using 23073-1-AP (same clone as 23073-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 23073-1-AP (SUPT6H antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23073-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 23073-1-AP (same clone as 23073-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 23073-1-AP (SUPT6H antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23073-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 23073-1-AP (same clone as 23073-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 23073-1-AP (SUPT6H antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23073-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 23073-1-AP (same clone as 23073-1-PBS)

  IP result of anti-SUPT6H (IP:23073-1-AP, 4ug; Detection:23073-1-AP 1:1000) with HEK-293 cells lysate 1200ug. This data was developed using the same antibody clone with 23073-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 23073-1-AP (same clone as 23073-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 23073-1-AP (SUPT6H antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23073-1-PBS in a different storage buffer formulation.

SUPT6H Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 23073-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

SPT6H, SPT6, KIAA0162, hSPT6, Histone chaperone suppressor of Ty6

---

Product Information

23073-1-PBS targets SUPT6H in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19426

  Product name: Recombinant human SUPT6H protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1618-1726 aa of BC136524

  Sequence: TPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR

• Full Name: suppressor of Ty 6 homolog (S. cerevisiae)
• Calculated Molecular Weight: 1726 aa, 199 kDa
• Observed Molecular Weight: 230 kDa
• GenBank Accession Number: BC136524
• Gene Symbol: SUPT6H
• Gene ID (NCBI): 6830
• RRID: AB_11232593
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7KZ85
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SUPT6H (suppressor of Ty6 homolog), also known as SPT6, SPT6H, Tat-CT2 (Tat-cotransactivator 2 protein) or emb-5 in C. elegans, is a 1,726 amino acid protein that is highly conserved from yeast to humans. Expressed ubiquitously, SUPT6H localizes to the nucleus and contains one SH2 domain and one S1 domain. SUPT6H participates in both DRB (5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole)-mediated transcriptional inhibition as well as the enhancement of transcriptional elongation by the RNA polymerase II (Pol II). SUPT6H interacts with the nuclear proteins SPT4 and SPT5, which comprise the DSIF (DRB-sensitivity-inducing factor) complex that binds RNA polymerase II, and directly regulates elongation. Via its C-terminus, SUPT6H can also interact with Histone H3. Due to alternative splicing events, three isoforms exist for SUPT6H. This antibody specifically recognizes the 230kd phosphorylated SUPT6H protein.