SUV39H2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SUV39H2 Polyclonal antibody, PBS Only (11338-1-PBS)

• 

  WB analysis of HEK-293 using 11338-1-AP (same clone as 11338-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11338-1-AP (SUV39H2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11338-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SUV39H2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11338-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11338-1-PBS targets SUV39H2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1882

  Product name: Recombinant human SUV39H2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-350 aa of BC007754

  Sequence: VKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN

• Full Name: suppressor of variegation 3-9 homolog 2 (Drosophila)
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC007754
• Gene Symbol: SUV39H2
• Gene ID (NCBI): 79723
• RRID: AB_2196730
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5I1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.