Product Information
32511-1-PBS targets SVIP in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36618 Product name: Recombinant human SVIP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-77 aa of NM_001320340 Sequence: MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS Predict reactive species |
| Full Name | small VCP/p97-interacting protein |
| Calculated Molecular Weight | 8kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | NM_001320340 |
| Gene Symbol | SVIP |
| Gene ID (NCBI) | 258010 |
| RRID | AB_3742639 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8NHG7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SVIP (Small VCP-interacting protein) is a 9-Kda adaptor endoplasmic reticulum protein that could bind directly to p97/VCP. SVIP is located on the ER membrane's cytosolic surface. It inhibits the ERAD pathway, which is known independently of ubiquitin, by interacting with p97/VCP, which has a central role in this pathway. Especially for the ERAD pathway, the SVIP protein has been identified as a negative regulator. SVIP was identified as a novel adapter protein for p97/VCP by observing its overexpression in cells, which causes extensive vacuolation and deformation of the ER and microtubules (PMID: 39473740).
