SYF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SYF2 Polyclonal antibody, PBS Only (16958-1-PBS)

• 

  WB analysis of HEK-293 using 16958-1-AP (same clone as 16958-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16958-1-AP (SYF2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16958-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 16958-1-AP (same clone as 16958-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16958-1-AP (SYF2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16958-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 16958-1-AP (same clone as 16958-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HEK-293 cells using 16958-1-AP (SYF2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16958-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SYF2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16958-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16958-1-PBS targets SYF2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10656

  Product name: Recombinant human SYF2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-243 aa of BC010862

  Sequence: MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTKQIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKFNKKAERFYGKYTAEIKQNLERGTAV

• Full Name: SYF2 homolog, RNA splicing factor (S. cerevisiae)
• Calculated Molecular Weight: 243 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC010862
• Gene Symbol: SYF2
• Gene ID (NCBI): 25949
• RRID: AB_2197205
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95926
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.