• Featured Product
  • KD/KO Validated

SYK Polyclonal antibody

SYK Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 14858-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

EC:2.7.10.2, IMD82, p72-Syk, spleen tyrosine kinase, Tyrosine protein kinase SYK

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDaudi cells, Raji cells, Ramos cells
Positive IHC detected inhuman liver cancer tissue, human appendicitis tissue, human spleen tissue, human kidney tissue, human ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14858-1-AP targets SYK in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6657

Product name: Recombinant human SYK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 368-635 aa of BC001645

Sequence: KLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN

Predict reactive species
Full Name spleen tyrosine kinase
Calculated Molecular Weight 72 kDa
Observed Molecular Weight66-72 kDa
GenBank Accession NumberBC001645
Gene Symbol SYK
Gene ID (NCBI) 6850
ENSEMBL Gene IDENSG00000165025
RRIDAB_2878086
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43405
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SYK belongs to the protein kinase superfamily, Tyr protein kinase family and SYK/ZAP-70 subfamily. It is positive effector of BCR-stimulated responses. SYK couples the B-cell antigen receptor (BCR) to the mobilization of calcium ion either through a phosphoinositide 3-kinase-dependent pathway, when not phosphorylated on tyrosines of the linker region, or through a phospholipase C-gamma-dependent pathway It phosphorylates USP25 and regulates its intracellular levels. SYK also promotes liver fibrosis by activation of hepatic stellate cells and acts as a biomarker for human hepatocellular carcinoma. (PMID: 29537660) SYK can be detected 66-72 kDa in human and mouse (PMID: 37661351).

Protocols

Product Specific Protocols
WB protocol for SYK antibody 14858-1-APDownload protocol
IHC protocol for SYK antibody 14858-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Food Funct

Synergistic effects of L-theanine and epigallocatechin gallate in alleviating ovalbumin allergy by regulating intestinal immunity through inhibition of mast cell degranulation

Authors - Wei Xu
mouseWB

Int Immunopharmacol

SAP130 released by ferroptosis tubular epithelial cells promotes macrophage polarization via Mincle signaling in sepsis acute kidney injury

Authors - Jing Zhang
mouseIHC

J Ethnopharmacol

Yiqi Kaimi prescription regulates protein phosphorylation to promote intestinal motility in slow transit constipation

Authors - Yi-Bo Yao
mouseWB

Brain Res

Inhibition of TREM-1 alleviates neuroinflammation by modulating microglial polarization via SYK/p38MAPK signaling pathway after traumatic brain injury

Authors - Tianqi Zhao
mouseWB

Int J Biol Macromol

A nanobody-enzyme fusion protein targeting PD-L1 and sialic acid exerts anti-tumor effects by C-type lectin pathway-mediated tumor associated macrophages repolarizing

Authors - Yongliang Tong
mouseWB

Res Vet Sci

TYROBP modulates NFκB phosphorylation and SQSTM1 expression in macrophages during Brucella Abortus LPS infection

Authors - Wenping Wu
Loading...
||
New chat Able
正在加载,请稍候...