SYNCRIP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SYNCRIP Polyclonal antibody, PBS Only (30443-1-PBS)

• 

  WB analysis using 30443-1-AP (same clone as 30443-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30443-1-AP (SYNCRIP antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30443-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 30443-1-AP (same clone as 30443-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30443-1-AP (SYNCRIP antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30443-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 30443-1-AP (same clone as 30443-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using SYNCRIP antibody (30443-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30443-1-PBS in a different storage buffer formulation.

SYNCRIP Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30443-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Glycine- and tyrosine-rich RNA-binding protein, GRY RBP, GRY-RBP, hnRNP Q, HNRPQ

---

Product Information

30443-1-PBS targets SYNCRIP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31509

  Product name: Recombinant human SYNCRIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 382-527 aa of BC032643

  Sequence: KAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGQGKGVEAGPDLLQ

• Full Name: synaptotagmin binding, cytoplasmic RNA interacting protein
• Calculated Molecular Weight: 623 aa, 70 kDa
• Observed Molecular Weight: 62-74 kDa
• GenBank Accession Number: BC032643
• Gene Symbol: SYNCRIP
• Gene ID (NCBI): 10492
• RRID: AB_3086317
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60506
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Synaptotagmin-binding, cytoplasmic RNA-interacting protein(SYNCRIP), also identified as hnRNP Q, involves in mRNA processing mechanisms. It's component of the CRD-mediated complex that promotes MYC mRNA stability. Also it is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. As previously reported, the 65 and 74 kDa proteins corresponded to two isoforms of SYNCRIP produced from alternatively spliced mRNAs (PMID: 15340051).