SYNJ1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SYNJ1 Polyclonal antibody, PBS Only (24677-1-PBS)

• 

  WB analysis of mouse brain using 24677-1-AP (same clone as 24677-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24677-1-AP (SYNJ1 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24677-1-AP (same clone as 24677-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24677-1-AP (SYNJ1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 24677-1-AP (same clone as 24677-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 24677-1-AP (SYNJ1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 24677-1-AP (same clone as 24677-1-PBS)

  IP result of anti-SYNJ1 (IP:24677-1-AP, 4ug; Detection:24677-1-AP 1:5000) with mouse brain tissue lysate 1960 ug. This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 24677-1-AP (same clone as 24677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 24677-1-AP (SYNJ1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 24677-1-AP (same clone as 24677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 24677-1-AP (SYNJ1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat skeletal muscle using 24677-1-AP (same clone as 24677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 24677-1-AP (SYNJ1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat skeletal muscle using 24677-1-AP (same clone as 24677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat skeletal muscle tissue slide using 24677-1-AP (SYNJ1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24677-1-AP (same clone as 24677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24677-1-AP (SYNJ1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24677-1-AP (same clone as 24677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24677-1-AP (SYNJ1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 24677-1-AP (same clone as 24677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24677-1-AP (SYNJ1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 24677-1-AP (same clone as 24677-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 24677-1-AP (SYNJ1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 24677-1-AP (same clone as 24677-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed NIH/3T3 cells using 24677-1-AP (SYNJ1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24677-1-PBS in a different storage buffer formulation.

SYNJ1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 24677-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

EC:3.1.3.36, INPP5G, KIAA0910, Synaptic inositol 1,4,5-trisphosphate 5-phosphatase 1, synaptojanin 1

---

Product Information

24677-1-PBS targets SYNJ1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20364

  Product name: Recombinant human SYNJ1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 856-1125 aa of BC136603

  Sequence: PVVALIDIDIFEVEAEERQNIYKEVIAVQGPPDGTVLVSIKSSLPENNFFDDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPSAQSSPIDAQPATPLPQKDPAQPLEPKRPPPPRPVAPPTRPAPPQRPPPPS

• Full Name: synaptojanin 1
• Calculated Molecular Weight: 1612 aa, 178 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC136603
• Gene Symbol: SYNJ1
• Gene ID (NCBI): 8867
• RRID: AB_2879668
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43426
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Synaptojanin 1, a polyphosphoinositide phosphatase, is expressed as two major alternatively spliced isoforms of 145 kDa (SJ145) and 170 kDa (SJ170), which are thought to have pleiotropic roles in endocytosis, signaling, and actin function. SJ145 is highly enriched in nerve terminals where it participates in clathrin-dependent synaptic vesicle recycling. SJ170, which differs from SJ145 by the presence of a carboxy-terminal extension, is the predominant isoform in developing neurons and is expressed in a variety of tissues (PMID:10801423).