Synaptoporin Polyclonal antibody

• 

  WB analysis using 14143-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14143-1-AP (Synaptoporin antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 14143-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14143-1-AP (Synaptoporin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse cerebellum using 14143-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 14143-1-AP (Synaptoporin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 14143-1-AP

  IP result of anti-Synaptoporin (IP:14143-1-AP, 4ug; Detection:14143-1-AP 1:2000) with mouse brain tissue lysate 1720 ug.

• 

  IHC staining of mouse brain using 14143-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14143-1-AP (Synaptoporin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 14143-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 14143-1-AP (Synaptoporin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 14143-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 14143-1-AP (Synaptoporin antibody at dilution of 1:50.

• 

  IHC staining of human gliomas using 14143-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 14143-1-AP (Synaptoporin antibody at dilution of 1:50.

• 

  IHC staining of human colon using 14143-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14143-1-AP (Synaptoporin antibody at dilution of 1:50.

• 

  IHC staining of human colon using 14143-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14143-1-AP (Synaptoporin antibody at dilution of 1:50.

• 

  IHC staining of human brain using 14143-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 14143-1-AP (Synaptoporin antibody at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 14143-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 14143-1-AP (Synaptoporin antibody at dilution of 1:50 (under 40x lens).

• 

  IF Staining of rat brain using 14143-1-AP

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded rat brain tissue using Synaptoporin antibody (14143-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Synaptoporin Polyclonal Antibody for WB, IHC, IF-Fro, IP, ELISA

Cat No. 14143-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-Fro, IP, ELISA

Synonyms

SYNPR, SPO

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue, mouse cerebellum tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue, human colon tissue, human gliomas tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-Fro detected in: rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 2 publications below

Product Information

14143-1-AP targets Synaptoporin in WB, IHC, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5307

  Product name: Recombinant human SYNPR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 15-265 aa of BC022518

  Sequence: FATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLHQVTFEVPTCEGKERQKLALIGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIVTVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAIHSPVMSSLNTSVVFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGGYNQDSYGSSSGYSQQASLGPTSDEFGQQPTGPTSFTNQI

• Full Name: synaptoporin
• Calculated Molecular Weight: 265 aa, 29 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC022518
• Gene Symbol: Synaptoporin
• Gene ID (NCBI): 132204
• RRID: AB_2878022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TBG9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Biomedicines; Combined DiI and Antibody Labeling Reveals Complex Dysgenesis of Hippocampal Dendritic Spines in a Mouse Model of Fragile X Syndrome; Authors - Luisa Speranza
mouse	IF	CNS Neurosci Ther; Inhibition of ANXA2 activity attenuates epileptic susceptibility and GluA1 phosphorylation; Authors - Limin Ma

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Cajsa (Verified Customer) (10-07-2024)

Great antibody!

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:300
• Cell Tissue Type: Myenteric plexus of adult mouse intestine