SYS1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SYS1 Polyclonal antibody, PBS Only (27048-1-PBS)

• 

  IHC staining of human kidney using 27048-1-AP (same clone as 27048-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27048-1-AP (SYS1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27048-1-PBS in a different storage buffer formulation.

SYS1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 27048-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

C20orf169, Protein SYS1 homolog

---

Product Information

27048-1-PBS targets SYS1 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24719

  Product name: Recombinant human SYS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-76 aa of BC048286

  Sequence: MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVRSSPSLDQMFDAEILGFSTPPGRLSMMSFILNALT

• Full Name: SYS1 Golgi-localized integral membrane protein homolog (S. cerevisiae)
• Calculated Molecular Weight: 156 aa, 18 kDa
• GenBank Accession Number: BC048286
• Gene Symbol: SYS1
• Gene ID (NCBI): 90196
• RRID: AB_3742212
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N2H4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SYS1 forms a complex with ADP-ribosylation factor-related protein-1 (ARFRP1; 604699) and targets ARFRP1 to the Golgi apparatus(PMID: 15077113).