Synaptotagmin-1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83637-4-RR (same clone as 83637-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83637-4-RR (Synaptotagmin-1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83637-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83637-4-RR (same clone as 83637-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83637-4-RR (Synaptotagmin-1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83637-4-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 83637-4-RR (same clone as 83637-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using Synaptotagmin-1 antibody (83637-4-RR, Clone: 240589F6 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83637-4-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 83637-4-RR (same clone as 83637-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using Synaptotagmin-1 antibody (83637-4-RR, Clone: 240589F6 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83637-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83637-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83637-4-RR against Human Synaptotagmin-1 were performed. The affinity constant is 20.5 nM.

Synaptotagmin-1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 83637-4-PBS

Clone No.240589F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Synaptotagmin 1, SYT1, SYT, synaptotagmin I, SVP65

---

Product Information

83637-4-PBS targets Synaptotagmin-1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5970

  Product name: Recombinant human SYT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 97-422 aa of BC058917

  Sequence: GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

• Full Name: synaptotagmin I
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC058917
• Gene Symbol: Synaptotagmin-1
• Gene ID (NCBI): 6857
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P21579
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT1 (synaptotagmin I) was firstly identified as a 65-kDa protein with a wide distribution in neuronal and neurosecretory tissue (PMID: 7298720). Calcium binding to SYT1 participates in triggering neurotransmitter release at the synapse (PMID: 11242035). In addition to regulating exocytosis, SYT1 has also been implicated in endocytosis and neurite outgrowth (PMID: 15492212; 11078930; 10336114). This antibody recognizes endogenous SYT1, which has an experimentally determined molecular mass of 65-68 kDa. An additional band of 47 kDa could also be detected, which is corresponding to the calculated molecular weight of SYT1.