Synaptotagmin-1 Recombinant monoclonal antibody

Synaptotagmin-1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 83637-4-RR
Clone No.240589F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synaptotagmin 1, SYT1, SYT, synaptotagmin I, SVP65

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse cerebellum tissue, rat brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83637-4-RR targets Synaptotagmin-1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5970

Product name: Recombinant human SYT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 97-422 aa of BC058917

Sequence: GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

Predict reactive species
Full Name synaptotagmin I
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC058917
Gene Symbol Synaptotagmin-1
Gene ID (NCBI) 6857
RRIDAB_3671249
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP21579
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT1 (synaptotagmin I) was firstly identified as a 65-kDa protein with a wide distribution in neuronal and neurosecretory tissue (PMID: 7298720). Calcium binding to SYT1 participates in triggering neurotransmitter release at the synapse (PMID: 11242035). In addition to regulating exocytosis, SYT1 has also been implicated in endocytosis and neurite outgrowth (PMID: 15492212; 11078930; 10336114). This antibody recognizes endogenous SYT1, which has an experimentally determined molecular mass of 65-68 kDa. An additional band of 47 kDa could also be detected, which is corresponding to the calculated molecular weight of SYT1.

Protocols

Product Specific Protocols
IF protocol for Synaptotagmin-1 antibody 83637-4-RRDownload protocol
IHC protocol for Synaptotagmin-1 antibody 83637-4-RRDownload protocol
WB protocol for Synaptotagmin-1 antibody 83637-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...