Synaptotagmin-13 Polyclonal antibody

• 

  WB analysis of HepG2 using 18115-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18115-1-AP (Synaptotagmin-13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 18115-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18115-1-AP (Synaptotagmin-13 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 18115-1-AP

  Immunohistochemical analysis of paraffin-embedded stomach cancer slide using 18115-1-AP (Synaptotagmin-13 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Synaptotagmin-13 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18115-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

SytXIII, SYT13, Synaptotagmin XIII, KIAA1427

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

18115-1-AP targets Synaptotagmin-13 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12599

  Product name: Recombinant human SYT13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-426 aa of BC093830

  Sequence: CLCRHMHPKKGLLPRDQDPDLEKAKPSLLGSAQQFNVKKSTEPVQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDSRLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLPLAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSAKEPSAGAGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQARKLKKKQTKRAKHKINPVWNEMIMFELPDDLLQASSVELEVLGQDDSGQSCALGHCSLGLHTSGSERSHWEEMLKNPRRQIAMWHQLHL

• Full Name: synaptotagmin XIII
• Calculated Molecular Weight: 426 aa, 47 kDa
• Observed Molecular Weight: 47 kDa, 66 kDa
• GenBank Accession Number: BC093830
• Gene Symbol: Synaptotagmin-13
• Gene ID (NCBI): 57586
• RRID: AB_2199453
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L8C5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Synaptotagmin-13 is a member of the synaptotagmin family of proteins which are known as membrane trafficking proteins. Synaptotagmin-13 is composed of the canonical domains of synaptotagmins that include an N-terminal transmembrane region, two C-terminal cytoplasmic C2-domains, and a connecting sequence between the transmembrane region and the C2-domains (PMID: 11211934). Synaptotagmin-13 is highly expressed in brain and may be involved in transport vesicle docking to the plasma membrane.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Brain; Key role of SMN/SYNCRIP and RNA-Motif 7 in spinal muscular atrophy: RNA-Seq and motif analysis of human motor neurons.; Authors - Federica Rizzo