SYT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SYT2 Polyclonal antibody, PBS Only (21245-1-PBS)

• 

  WB analysis using 21245-1-AP (same clone as 21245-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21245-1-AP (SYT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21245-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21245-1-AP (same clone as 21245-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21245-1-AP (SYT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21245-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 21245-1-AP (same clone as 21245-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using SYT2 antibody (21245-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21245-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 21245-1-AP (same clone as 21245-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using SYT2 antibody (21245-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21245-1-PBS in a different storage buffer formulation.

SYT2 Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 21245-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Synonyms

Synaptotagmin II, Synaptotagmin-2, SytII

---

Product Information

21245-1-PBS targets SYT2 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15744

  Product name: Recombinant human SYT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-60 aa of BC100815

  Sequence: MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPL

• Full Name: synaptotagmin II
• Calculated Molecular Weight: 419 aa, 47 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC100815
• Gene Symbol: SYT2
• Gene ID (NCBI): 127833
• RRID: AB_3085646
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N9I0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SYT2 (Synaptotagmin-2) a synaptic vesicle membrane protein, functions as a calcium sensor in vesicular trafficking and exocytosis. SYT2 is also plays a role in dendrite formation by melanocytes (PMID: 23999003). Mutations in SYT2 are associated with myasthenic syndrome, presynaptic, congenital, with or without motor neuropathy. SYT2 mutations cause a complex presynaptic congenital myasthenic syndrome (PMID: 26519543).