Sam50 Monoclonal antibody, PBS Only

• 

  IF Staining of HepG2 using 67425-1-Ig (same clone as 67425-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Sam50 antibody (67425-1-Ig, Clone: 2H6H9 ) at dilution of 1:1500 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 67425-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67425-1-Ig (same clone as 67425-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Sam50 antibody (67425-1-Ig, Clone: 2H6H9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67425-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67425-1-Ig (same clone as 67425-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Sam50 antibody (67425-1-Ig, Clone: 2H6H9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). F-actin was stained using CL594-phalloidin (red) and DNA was stained by DAPI (blue). This data was developed using the same antibody clone with 67425-1-PBS in a different storage buffer formulation.

Sam50 Monoclonal Antibody for IF/ICC, ELISA

Cat No. 67425-1-PBS

Clone No.2H6H9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, ELISA

Synonyms

SAMM50, 2H6H9, CGI 51, CGI-51, OMP85

---

Product Information

67425-1-PBS targets Sam50 in IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15155

  Product name: Recombinant human SAMM50 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 119-468 aa of BC007830

  Sequence: TFEVTELRRLTGSYNTMVGNNEGSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDFELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSVRGFSMHSIGPQSEGDYLGGEAYWAGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL

• Full Name: sorting and assembly machinery component 50 homolog (S. cerevisiae)
• Calculated Molecular Weight: 469 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC007830
• Gene Symbol: Sam50
• Gene ID (NCBI): 25813
• RRID: AB_2882664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y512
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sam50, encoded by the SAMM50 gene, is an essential protein of the mitochondrial outer membrane (OMM). It contains a beta-barrel domain conserved from bacteria to man (PMID: 14570913). Sam50 is a part of the sorting and assembly machinery (SAM) necessary for the assembly of beta-barrel proteins in the OMM (PMID: 22252321). It is crucial for maintaining mitochondrial shape, morphology of mitochondrial cristae, and assembly of the mitochondrial respiratory chain complexes (PMID: 26587038; 22252321; 25781180). Polymorphisms in the SAMM50 gene have been associated with development and progression of nonalcoholic fatty liver disease (PMID: 23535911).