Use Able AI chat for product recommendations

Secretogranin V Monoclonal antibody

Secretogranin V Monoclonal Antibody for IHC, ELISA

Cat No. 67406-1-Ig
Clone No.1B9H6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, ELISA

SCG5, 1B9H6, 7B2, C-terminal peptide, Neuroendocrine protein 7B2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman pituitary adenoma tissue, human pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:800-1:3200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67406-1-Ig targets Secretogranin V in IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28607

Product name: Recombinant human SCG5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-212 aa of BC005349

Sequence: MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLSDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE

Predict reactive species
Full Name secretogranin V (7B2 protein)
Calculated Molecular Weight 24 kDa
GenBank Accession NumberBC005349
Gene Symbol Secretogranin V
Gene ID (NCBI) 6447
RRIDAB_2882647
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP05408
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Secretogranin V (also known as SCG5, 7B2, or SGNE1) is a member of the granin family of acidic secretory proteins that plays an essential regulatory role in the neuroendocrine system. Its primary function is to act as both a chaperone and a specific inhibitor of prohormone convertase 2 (PC2), a key enzyme responsible for processing prohormones into bioactive hormones and neuropeptides. Secretogranin V facilitates the proper folding and transport of proPC2 through the secretory pathway and subsequently inhibits the enzymatic activity of mature PC2 to ensure precise hormone activation. In terms of expression, SCG5 is predominantly found in neuroendocrine tissues, including the pituitary gland, pancreas, adrenal medulla, and distinct regions of the central nervous system such as the cerebral cortex and cerebellum. Dysregulation of Secretogranin V has been linked to several human diseases, including diabetes, Cushing's disease, and certain neuroendocrine tumors, highlighting its clinical significance in hormone homeostasis

Protocols

Product Specific Protocols
IHC protocol for Secretogranin V antibody 67406-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...