Secretogranin V Monoclonal antibody

• 

  IHC staining of human pituitary adenoma using 67406-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 67406-1-Ig (Secretogranin V antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pituitary adenoma using 67406-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pituitary adenoma tissue slide using 67406-1-Ig (Secretogranin V antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Secretogranin V Monoclonal Antibody for IHC, ELISA

Cat No. 67406-1-Ig

Clone No.1B9H6

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IHC, ELISA

Synonyms

7B2, Neuroendocrine protein 7B2, P7B2, Pituitary polypeptide, SCG5, Secretogranin 5, Secretogranin V, secretogranin V (7B2 protein), SGNE1, SgV

---

Tested Applications

• Positive IHC detected in: human pituitary adenoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:2000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67406-1-Ig targets Secretogranin V in IHC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28607

  Product name: Recombinant human SCG5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-212 aa of BC005349

  Sequence: MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLSDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE

• Full Name: secretogranin V (7B2 protein)
• Calculated Molecular Weight: 24 kDa
• GenBank Accession Number: BC005349
• Gene Symbol: Secretogranin V
• Gene ID (NCBI): 6447
• RRID: AB_2882647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P05408
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.